Rabbit Polyclonal Anti-C18orf54 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C18orf54 antibody: synthetic peptide directed towards the middle region of human C18orf54. Synthetic peptide located within the following region: PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN |
Carrier-free (BSA/glycerol-free) C18orf54 mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
C18orf54 mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
C18orf54 mouse monoclonal antibody, clone OTI2B2 (formerly 2B2), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
C18orf54 mouse monoclonal antibody, clone OTI2B2 (formerly 2B2), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
C18orf54 mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China