C19orf18 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 147~176 amino acids from the Central region of human C19orf18 |
C19orf18 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 147~176 amino acids from the Central region of human C19orf18 |
Rabbit Polyclonal Anti-C19orf18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C19orf18 antibody: synthetic peptide directed towards the N terminal of human C19orf18. Synthetic peptide located within the following region: NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK |