USD 340.00
2 Weeks
SIAH Interacting Protein (CACYBP) mouse monoclonal antibody, clone AT3G8, Purified
Applications | ELISA, WB |
Reactivities | Human |
USD 340.00
2 Weeks
SIAH Interacting Protein (CACYBP) mouse monoclonal antibody, clone AT3G8, Purified
Applications | ELISA, WB |
Reactivities | Human |
USD 230.00
2 Weeks
SIAH Interacting Protein (CACYBP) mouse monoclonal antibody, clone AT3G8, Purified
Applications | ELISA, WB |
Reactivities | Human |
Rabbit Polyclonal antibody to CacyBP (calcyclin binding protein)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of CacyBP (Uniprot ID#Q9HB71) |
Rabbit Polyclonal Anti-CACYBP
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACYBP antibody: synthetic peptide directed towards the middle region of human CACYBP. Synthetic peptide located within the following region: FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK |
CACYBP Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-228 of human CACYBP (NP_055227.1). |
Modifications | Unmodified |