Antibodies

Jump to Filters
View as table Download
CCDC90B (Center) Rabbit Polyclonal Antibody
AP50797PU-N

USD 450.00

2 Weeks

CCDC90B (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 122-152 amino acids from the Central region of human CCDC90B
Ccdc90b Rabbit Polyclonal Antibody
TA338478

USD 375.00

5 Days

Rabbit Polyclonal Anti-Ccdc90b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ccdc90b antibody is: synthetic peptide directed towards the middle region of Rat Ccdc90b. Synthetic peptide located within the following region: VKQQLINETSRIRADNRLDINLERSRVTDMFTDQEKQLMEATNEFTKKDM
Ccdc90b Rabbit Polyclonal Antibody
TA356823

USD 360.00

5 Days

Ccdc90b Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated