Antibodies

View as table Download

Rabbit Polyclonal Anti-CCNJ Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNJ antibody: synthetic peptide directed towards the N terminal of human CCNJ. Synthetic peptide located within the following region: FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL

Ccnj Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated

CCNJ rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCNJ

CCNJ rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CCNJ