Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-CCT7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CCT7. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CCT7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCT7 antibody: synthetic peptide directed towards the middle region of human CCT7. Synthetic peptide located within the following region: RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR |
CCT7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 310-500 of human CCT7 (NP_006420.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CCT7