Antibodies

Jump to Filters
View as table Download
CD300LB Rabbit Polyclonal Antibody
TA331590

USD 375.00

5 Days

Rabbit Polyclonal Anti-CD300LB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CD300LB Antibody is: synthetic peptide directed towards the middle region of Human CD300LB. Synthetic peptide located within the following region: CRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDA
CD300LB Rabbit Polyclonal Antibody
TA374437

USD 220.00

3 Weeks

CD300LB Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-201 of human CD300LB (NP_777552.3).
Modifications Unmodified
CD300LB Rabbit Polyclonal Antibody
TA383930

USD 380.00

4 Weeks

CD300b Rabbit polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide from human protein at AA range: 61-110