Rabbit polyclonal Anti-C6orf182 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C6orf182 antibody: synthetic peptide directed towards the middle region of human C6orf182. Synthetic peptide located within the following region: LNVEREKNMILEQQAQLQREKEQDQMKLYAKLEKLDVLEKECFRLTTTQK |
Rabbit polyclonal Anti-C6orf182 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C6orf182 antibody: synthetic peptide directed towards the middle region of human C6orf182. Synthetic peptide located within the following region: DIECELECLLKKMEIKGEQISKLKKHQDSVCKLQQKVQNSKMSEASGIQQ |
CEP57L1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human CEP57L1 (NP_776191.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China