Germany
Japan
United Kingdom
China
Goat Anti-COL4A3BP (aa396-411) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KREDSWQKRLDKETEK, from the internal region of the protein sequence according to NP_005704.1; NP_112729.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-COL4A3BP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL4A3BP antibody: synthetic peptide directed towards the N terminal of human COL4A3BP. Synthetic peptide located within the following region: PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL |
Rabbit Polyclonal Anti-COL4A3BP Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human COL4A3BP |
CERT1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CERT1 |
Active filters
Target Symbol
- CERT1