Antibodies

Jump to Filters
View as table Download
CFHR5 Rabbit Polyclonal Antibody
TA337960

USD 375.00

5 Days

Rabbit Polyclonal Anti-CFHR5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CFHR5 antibody is: synthetic peptide directed towards the N-terminal region of Human CFHR5. Synthetic peptide located within the following region: SCVERGWSTPPICSFTKGECHVPILEANVDAQPKKESYKVGDVLKFSCRK
CFHR5 Rabbit Polyclonal Antibody
TA374679

USD 220.00

3 Weeks

CFHR5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 450-569 of human CFHR5 (NP_110414.1).
Modifications Unmodified