Germany
Japan
United Kingdom
China
CIAO1 mouse monoclonal antibody, clone AT6C9, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Antibodies
View as table Download
CIAO1 mouse monoclonal antibody, clone AT6C9, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-WDR39 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-WDR39 Antibody: synthetic peptide directed towards the C terminal of human WDR39. Synthetic peptide located within the following region: LSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTA |
Rabbit Polyclonal Anti-CIAO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CIAO1 Antibody: synthetic peptide directed towards the middle region of human CIAO1. Synthetic peptide located within the following region: SVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGH |
Rabbit Polyclonal Anti-Ciao1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ciao1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ciao1. Synthetic peptide located within the following region: MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSW |
Rabbit Polyclonal Anti-WDR39 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR39 antibody: synthetic peptide directed towards the C terminal of human WDR39. Synthetic peptide located within the following region: HSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQ |
CIAO1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CIAO1 |
CIAO1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-339 of human CIAO1 (NP_004795.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CIAO1