Antibodies

Jump to Filters
View as table Download
LECT1 (CNMD) Rabbit Polyclonal Antibody
TA371407

USD 380.00

4 Weeks

CNMD rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CNMD
LECT1 (CNMD) Rabbit Polyclonal Antibody
TA335669

USD 375.00

5 Days

Rabbit Polyclonal Anti-LECT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LECT1 Antibody: synthetic peptide directed towards the N terminal of human LECT1. Synthetic peptide located within the following region: AIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGK