Antibodies

Jump to Filters
View as table Download
CNNM2 Rabbit Polyclonal Antibody
TA315539

USD 345.00

In Stock

Rabbit polyclonal anti-CNNM2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CNNM2.
CNNM2 Rabbit Polyclonal Antibody
TA342032

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNNM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNNM2 antibody: synthetic peptide directed towards the middle region of human CNNM2. Synthetic peptide located within the following region: EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL