Antibodies

Jump to Filters
View as table Download
Collagen XV (COL15A1) Rabbit Polyclonal Antibody
TA319128

USD 355.00

3 Weeks

Rabbit polyclonal anti-Endostatin antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human Endostatin
Collagen XV (COL15A1) Rabbit Polyclonal Antibody
TA342547

USD 375.00

5 Days

Rabbit Polyclonal Anti-Col15a1 Antibody

Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Col15a1 antibody is: synthetic peptide directed towards the middle region of Rat Col15a1. Synthetic peptide located within the following region: ASGQPGMKGEKGARGPNGSVGEKGDPGSRGLPGPPGKNGEVGIPGAMGPP
Collagen XV (COL15A1) Mouse Monoclonal Antibody [Clone ID: OTI1C5]
CF507124

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) COL15A1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
COL15A1 Rabbit Polyclonal Antibody
TA367453

USD 380.00

4 Weeks

COL15A1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human COL15A1