Antibodies

Jump to Filters
View as table Download
COL6A5 Rabbit Polyclonal Antibody
TA333468

USD 375.00

5 Days

Rabbit Polyclonal Anti-COL6A5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-COL6A5 Antibody is: synthetic peptide directed towards the C-terminal region of Human COL6A5. Synthetic peptide located within the following region: RNVSLRAKCQGYSIFVFSFGPKHNDKELEELASHPLDHHLVQLGRTHKPD