Antibodies

View as table Download

Rabbit Polyclonal Anti-CRYGC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRYGC antibody: synthetic peptide directed towards the middle region of human CRYGC. Synthetic peptide located within the following region: GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE

Carrier-free (BSA/glycerol-free) CRYGC mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CRYGC mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CRYGC Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-174 of human CRYGC (NP_066269.1).
Modifications Unmodified

CRYGC (Gamma C Crystallin) mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CRYGC (Gamma C Crystallin) mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated