Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against PSCDBP
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SLQRLLQHSSNGN-C, from the N Terminus of the protein sequence according to NP_004279.3. |
Antibodies
View as table Download
Rabbit polyclonal antibody to PSCDBP (pleckstrin homology, Sec7 and coiled-coil domains, binding protein)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 44 of PSCDBP (Uniprot ID#O60759) |
Rabbit polyclonal anti-Cybr antibody
| Applications | WB |
| Reactivities | Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region in the carboxy terminal portion of mouse Cybr. |
Rabbit polyclonal anti-Cybr antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PSCDBP antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region in the C-terminal portion of mouse Cybr. |
Rabbit Polyclonal Anti-CYTIP Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cytip antibody is: synthetic peptide directed towards the C-terminal region of Mouse Cytip. Synthetic peptide located within the following region: RNRSISVTSSGSFSPLWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHR |
CYTIP Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CYTIP rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CYTIP |
Active filters
Target Symbol
- CYTIP