Antibodies

Jump to Filters
View as table Download
CCDC28A Rabbit Polyclonal Antibody
TA333821

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCDC28A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CCDC28A Antibody: synthetic peptide directed towards the middle region of human CCDC28A. Synthetic peptide located within the following region: ERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELE
CCDC28A Rabbit Polyclonal Antibody
TA359303

USD 360.00

5 Days

CCDC28A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC28A