Germany
Japan
United Kingdom
China
PCTAIRE3 (CDK18) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 437-467 amino acids from the C-terminal region of Human CDK18 / PCTK3 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CDK18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCTK3 antibody: synthetic peptide directed towards the N terminal of human PCTK3. Synthetic peptide located within the following region: IMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLG |
CDK18 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CDK18 |
CDK18 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 373-474 of human CDK18 (NP_002587.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CDK18