Antibodies

View as table Download

CERK rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Human
Immunogen Synthetic peptide derived from human ceramide kinase protein

Rabbit Polyclonal Anti-CERK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CERK antibody is: synthetic peptide directed towards the C-terminal region of Human CERK. Synthetic peptide located within the following region: FVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSS

Rabbit Polyclonal Antibody against Ceramide Kinase

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human ceramide kinase protein sequence (between residues 50-150). [Swiss-Prot Q8TCT0]

Rabbit Polyclonal Anti-CERK Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Ceramide Kinase / CERK antibody was raised against synthetic 14 amino acid peptide from internal region of human CERK. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Panda (100%); Gorilla, Dog, Elephant, Horse (93%); Mouse, Rat, Hamster (86%).

Rabbit Polyclonal Anti-CERK Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Ceramide Kinase / CERK antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CERK. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset (90%); Dog, Panda (85%); Bovine, Elephant, Rabbit (80%).

Rabbit Polyclonal Anti-CERK Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CERK

CERK Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

CERK Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CERK

CERK rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CERK

CERK Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified