Antibodies

View as table Download

Rabbit Polyclonal Anti-CHCHD3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHCHD3 antibody: synthetic peptide directed towards the middle region of human CHCHD3. Synthetic peptide located within the following region: LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY

Rabbit Polyclonal Anti-CHCHD3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHCHD3 antibody: synthetic peptide directed towards the N terminal of human CHCHD3. Synthetic peptide located within the following region: RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR

Goat Anti-CHCHD3 (aa151-164) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSSEFYRVTTEQYQ, from the internal region of the protein sequence according to NP_060282.1.

Carrier-free (BSA/glycerol-free) CHCHD3 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHCHD3 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHCHD3 mouse monoclonal antibody, clone OTI7G4 (formerly 7G4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CHCHD3 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CHCHD3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

CHCHD3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

CHCHD3 Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human CHCHD3 (NP_060282.1).
Modifications Unmodified

CHCHD3 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CHCHD3 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CHCHD3 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

CHCHD3 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CHCHD3 mouse monoclonal antibody, clone OTI7G4 (formerly 7G4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

CHCHD3 mouse monoclonal antibody, clone OTI7G4 (formerly 7G4), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

CHCHD3 mouse monoclonal antibody, clone OTI7G4 (formerly 7G4), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

CHCHD3 mouse monoclonal antibody, clone OTI7G4 (formerly 7G4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CHCHD3 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

CHCHD3 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated