Antibodies

Jump to Filters
View as table Download
CHD4 Rabbit Polyclonal Antibody
TA313619

USD 345.00

In Stock

Rabbit polyclonal anti-CHD4 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHD4.
CHD4 Mouse Monoclonal Antibody [Clone ID: 5F1-A11-C9]
TA346917

USD 380.00

4 Weeks

Mouse Monoclonal CHD4 Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
CHD4 Rabbit Polyclonal Antibody
TA335875

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CHD4 Antibody: synthetic peptide directed towards the N terminal of human CHD4. Synthetic peptide located within the following region: QKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKL
CHD4 Rabbit Polyclonal Antibody
TA374719

USD 410.00

3 Weeks

CHD4 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified