CHRNA9 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CHRNA9 |
CHRNA9 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CHRNA9 |
Rabbit Polyclonal Anti-CHRNA9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA9 antibody: synthetic peptide directed towards the N terminal of human CHRNA9. Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE |
CHRNA9 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CHRNA9 antibody is: synthetic peptide directed towards the N-terminal region of Human ACHA9 |
CHRNA9 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CHRNA9 |
CHRNA9 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-240 of human CHRNA9 (NP_060051.2). |
Modifications | Unmodified |