Rabbit polyclonal anti-CHST8 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHST8. |
Rabbit polyclonal anti-CHST8 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHST8. |
CHST8 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 226-255 amino acids from the Central region of human CHST8 |
Rabbit Polyclonal Anti-CHST8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHST8 antibody: synthetic peptide directed towards the middle region of human CHST8. Synthetic peptide located within the following region: GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLST |
CHST8 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N region of human CHST8 |