Germany
Japan
United Kingdom
China
Rabbit Anti-Clavesin Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CLVS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLVS1 antibody: synthetic peptide directed towards the middle region of human CLVS1. Synthetic peptide located within the following region: MFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFT |
Rabbit Polyclonal Anti-CLVS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLVS1 antibody: synthetic peptide directed towards the N terminal of human CLVS1. Synthetic peptide located within the following region: NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDIL |
Active filters
Target Symbol
- CLVS1