CNTNAP3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CNTNAP3 |
CNTNAP3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CNTNAP3 |
Rabbit Polyclonal Anti-CNTNAP3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNTNAP3 antibody: synthetic peptide directed towards the middle region of human CNTNAP3. Synthetic peptide located within the following region: GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA |
Rabbit Polyclonal Anti-CNTNAP3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CNTNAP3 |