Germany
Japan
United Kingdom
China
CSNK2A2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CSNK2A2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CSNK2A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CSNK2A2 Antibody: synthetic peptide directed towards the C terminal of human CSNK2A2. Synthetic peptide located within the following region: GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD |
Rabbit Polyclonal Anti-CSNK2A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CSNK2A2 Antibody: synthetic peptide directed towards the C terminal of human CSNK2A2. Synthetic peptide located within the following region: LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
CSNK2A2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CSNK2A2 |
CSNK2A2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human CSNK2A2 (NP_001887.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CSNK2A2