Antibodies

Jump to Filters
View as table Download
CTTNBP2NL (N-term) Rabbit Polyclonal Antibody
AP51136PU-N

USD 450.00

2 Weeks

CTTNBP2NL (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 135-164 amino acids from the N-terminal region of human CTTNBP2NL
CTTNBP2NL Rabbit Polyclonal Antibody
TA331846

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTTNBP2NL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CTTNBP2NL Antibody is: synthetic peptide directed towards the N-terminal region of Human CTTNBP2NL. Synthetic peptide located within the following region: LEEERQRHAQDTAEGDDVTYMLEKERERLTQQLEFEKSQVKKFEKEQKKL