DBX2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DBX2 |
DBX2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DBX2 |
Rabbit Polyclonal DBX2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DBX2 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human DBX2. |
Rabbit Polyclonal Anti-DBX2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DBX2 antibody: synthetic peptide directed towards the middle region of human DBX2. Synthetic peptide located within the following region: SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLT |
Rabbit Polyclonal Anti-DBX2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DBX2 antibody: synthetic peptide directed towards the N terminal of human DBX2. Synthetic peptide located within the following region: ALLNLPAAPGFGNLGKSFLIENLLRVGGAPTPRLQPPAPHDPATALATAG |
DBX2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DBX2 |