Antibodies

Jump to Filters
View as table Download
Deformed Epidermal Autoregulatory Factor 1 (DEAF1) Rabbit Polyclonal Antibody
TA345314

USD 475.00

5 Days

Rabbit Polyclonal Anti-DEAF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DEAF1 antibody: synthetic peptide directed towards the N terminal of human DEAF1. Synthetic peptide located within the following region: EEPVLSRDEDSEEDADSEAERETPRVTAVAVMAAEPGHMDMGAEALPGPD
Deformed Epidermal Autoregulatory Factor 1 (DEAF1) Rabbit Polyclonal Antibody
TA345315

USD 475.00

5 Days

Rabbit Polyclonal Anti-DEAF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DEAF1 antibody: synthetic peptide directed towards the C terminal of human DEAF1. Synthetic peptide located within the following region: TGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVTV
Deformed Epidermal Autoregulatory Factor 1 (DEAF1) (C-term) Rabbit Polyclonal Antibody
AP51228PU-N

USD 450.00

2 Weeks

Deformed Epidermal Autoregulatory Factor 1 (DEAF1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 473-502 amino acids from the C-terminal region of human DEAF1
DEAF1 Rabbit Polyclonal Antibody
TA367033

USD 380.00

4 Weeks

DEAF1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DEAF1