Antibodies

Jump to Filters
View as table Download
DHX16 Rabbit Polyclonal Antibody
TA331470

USD 375.00

5 Days

Rabbit polyclonal Anti-DHX16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHX16 antibody: synthetic peptide directed towards the N terminal of human DHX16. Synthetic peptide located within the following region: KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV
DHX16 Rabbit Polyclonal Antibody
TA355826

USD 360.00

5 Days

DHX16 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated