DMRT3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 438-167 amino acids from the C-terminal region of human DMRT3 |
DMRT3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 438-167 amino acids from the C-terminal region of human DMRT3 |
Rabbit polyclonal anti-Dmrt3 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Dmrt3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GDAAATAATASQSSPASQASQPPAPPRPTAELAAAAALRWVAEPQPGTLP |
Rabbit Polyclonal Anti-DMRT3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DMRT3 Antibody: synthetic peptide directed towards the middle region of human DMRT3. Synthetic peptide located within the following region: ALQAQLAKPDLTEERLGDGKSADNTEVFSDKDTDQRSSPDVAKSKGCFTP |
Rabbit Polyclonal Anti-DMRT3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DMRT3 |
DMRT3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DMRT3 |