Antibodies

Jump to Filters
View as table Download
DUS4L (Center) Rabbit Polyclonal Antibody
AP51338PU-N

USD 450.00

2 Weeks

DUS4L (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 141-170 amino acids from the Central region of Human DUS4L
DUS4L Rabbit Polyclonal Antibody
TA331552

USD 375.00

5 Days

Rabbit Polyclonal Anti-DUS4L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DUS4L Antibody is: synthetic peptide directed towards the N-terminal region of Human DUS4L. Synthetic peptide located within the following region: SKLAFRTLVRKYSCDLCYTPMIVAADFVKSIKARDSEFTTNQGDCPLIVQ
DUS4L Rabbit Polyclonal Antibody
TA331553

USD 375.00

5 Days

Rabbit Polyclonal Anti-DUS4L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DUS4L Antibody is: synthetic peptide directed towards the middle region of Human DUS4L. Synthetic peptide located within the following region: ETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVH