Rabbit Polyclonal Anti-DDX19B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX19B antibody: synthetic peptide directed towards the N terminal of human DDX19B. Synthetic peptide located within the following region: DEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQS |
Rabbit Polyclonal Anti-DDX19B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX19B antibody: synthetic peptide directed towards the C terminal of human DDX19B. Synthetic peptide located within the following region: GKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG |
Rabbit polyclonal anti-DDX19B antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DDX19B. |
Goat Polyclonal Antibody against DDX19B
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DLPVDKDGNPDNETY, from the internal region of the protein sequence according to NP_009173.1; NP_001014451.1; NP_001014449.1; NP_060802.1. |
Ddx19b Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ddx19b |
DDX19B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N region of human DDX19B |
Germany
Japan
United Kingdom
China
