Antibodies

View as table Download

Rabbit Polyclonal Anti-DERL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DERL3 antibody: synthetic peptide directed towards the C terminal of human DERL3. Synthetic peptide located within the following region: YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP

Rabbit Polyclonal Anti-DERL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DERL3 antibody: synthetic peptide directed towards the middle region of human DERL3. Synthetic peptide located within the following region: FFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL