Antibodies

Jump to Filters
View as table Download
TTC35 (EMC2) Rabbit Polyclonal Antibody
TA346617

USD 475.00

5 Days

Rabbit Polyclonal Anti-TTC35 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TTC35 antibody: synthetic peptide directed towards the middle region of human TTC35. Synthetic peptide located within the following region: IQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQE
TTC35 (EMC2) Rabbit Polyclonal Antibody
TA359840

USD 360.00

5 Days

EMC2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human EMC2