Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-Mucin-14 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Mucin-14. |
Rabbit Polyclonal Anti-EMCN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EMCN antibody is: synthetic peptide directed towards the N-terminal region of Human EMCN. Synthetic peptide located within the following region: VTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTP |
EMCN Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human EMCN (NP_057326.2). |
| Modifications | Unmodified |
EMCN Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human EMCN (NP_057326.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EMCN