Antibodies

Jump to Filters
View as table Download
EMP2 Rabbit Polyclonal Antibody
TA346075

USD 410.00

5 Days

Rabbit Polyclonal Anti-EMP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EMP2 antibody: synthetic peptide directed towards the middle region of human EMP2. Synthetic peptide located within the following region: IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF
EMP2 Rabbit Polyclonal Antibody
TA351155

USD 345.00

In Stock

Rabbit Polyclonal Anti-EMP2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human EMP2
EMP2 Rabbit Polyclonal Antibody
TA367043

USD 380.00

4 Weeks

EMP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human EMP2