Antibodies

View as table Download

EPSTI1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human EPSTI1
TA373002 is a possible alternative to TA349937.

Rabbit Polyclonal Anti-EPSTI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPSTI1 antibody: synthetic peptide directed towards the N terminal of human EPSTI1. Synthetic peptide located within the following region: RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK

EPSTI1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human EPSTI1