Rabbit Polyclonal Anti-ERCC6L Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC6L antibody: synthetic peptide directed towards the N terminal of human ERCC6L. Synthetic peptide located within the following region: GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS |
ERCC6L Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ERCC6L (NP_060139.2). |
| Modifications | Unmodified |
ERCC6L Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ERCC6L (NP_060139.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
