Antibodies

Jump to Filters
View as table Download
TMEM166 (EVA1A) Rabbit Polyclonal Antibody
TA339601

USD 375.00

5 Days

Rabbit Polyclonal Anti-EVA1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMEM166 antibody: synthetic peptide directed towards the N terminal of human TMEM166. Synthetic peptide located within the following region: RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA
TMEM166 (EVA1A) Rabbit Polyclonal Antibody
TA351821

USD 345.00

In Stock

Rabbit Polyclonal Anti-EVA1A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EVA1A
TMEM166 (EVA1A) Rabbit Polyclonal Antibody
TA357500

USD 360.00

5 Days

TMEM166 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TMEM166
EVA1A Rabbit Polyclonal Antibody
TA367320

USD 380.00

4 Weeks

EVA1A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EVA1A