Rabbit Polyclonal Anti-CXorf67 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CXorf67 Antibody: synthetic peptide directed towards the middle region of human LOC340602. Synthetic peptide located within the following region: SSYASNSSSPSRSPGLSPSSPSPEFLGLRSISTPSPESLRYALMPEFYAL |
Rabbit Polyclonal Anti-CXorf67 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CXorf67 Antibody: synthetic peptide directed towards the middle region of human LOC340602. Synthetic peptide located within the following region: RRSLSGSADENPSCGTGSERLAFQSRSGSPDPEVPSRASPPVWHAVRMRA |
Germany
Japan
United Kingdom
China