Antibodies

View as table Download

EBNA1 binding protein 2 (EBNA1BP2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen conjugated synthetic peptide between 323-355 amino acids from the C-terminal region of Human EBNA1BP2.

Rabbit Polyclonal Anti-EBNA1BP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EBNA1BP2 antibody is: synthetic peptide directed towards the middle region of Human EBNA1BP2. Synthetic peptide located within the following region: VTLGPVPEIGGSEAPAPQNKDQKAVDPEDDFQREMSFYRQAQAAVLAVLP

EBNA1BP2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

EBNA1BP2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EBNA1BP2

EBNA1BP2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EBNA1BP2

EBNA1BP2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-306 of human EBNA1BP2 (NP_006815.2).
Modifications Unmodified