USD 428.00
In Stock
Rabbit monoclonal anti-EBP2 antibody for SISCAPA, clone OTIR3D2
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 428.00
In Stock
Rabbit monoclonal anti-EBP2 antibody for SISCAPA, clone OTIR3D2
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 450.00
2 Weeks
EBNA1 binding protein 2 (EBNA1BP2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | conjugated synthetic peptide between 323-355 amino acids from the C-terminal region of Human EBNA1BP2. |
Rabbit Polyclonal Anti-EBNA1BP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EBNA1BP2 antibody is: synthetic peptide directed towards the middle region of Human EBNA1BP2. Synthetic peptide located within the following region: VTLGPVPEIGGSEAPAPQNKDQKAVDPEDDFQREMSFYRQAQAAVLAVLP |
EBNA1BP2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
EBNA1BP2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EBNA1BP2 |
EBNA1BP2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EBNA1BP2 |
EBNA1BP2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-306 of human EBNA1BP2 (NP_006815.2). |
Modifications | Unmodified |