Antibodies

Jump to Filters
View as table Download
EFCAB1 Rabbit Polyclonal Antibody
TA335466

USD 375.00

5 Days

Rabbit Polyclonal Anti-EFCAB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EFCAB1 Antibody is: synthetic peptide directed towards the middle region of Human EFCAB1. Synthetic peptide located within the following region: EKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEI