Rabbit polyclonal antibody to eIF2B beta (eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 88 and 323 of EIF2B beta (Uniprot ID#P49770) |
Rabbit Polyclonal Anti-EIF2B2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF2B2 antibody is: synthetic peptide directed towards the N-terminal region of Human EIF2B2. Synthetic peptide located within the following region: YGRLHGRSDESDQQESLHKLLTSGGLNEDFSFHYAQLQSNIIEAINELLV |
Rabbit Polyclonal Anti-EIF2B2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF2B2 antibody is: synthetic peptide directed towards the middle region of Human EIF2B2. Synthetic peptide located within the following region: EGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKEAARKRKFHVIVAEC |
EIF2B2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EIF2B2 |
EIF2B2 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-351 of human EIF2B2 (NP_055054.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
