Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal EMX1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This EMX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 228-257 amino acids from the C-terminal region of human EMX1. |
Rabbit polyclonal anti-EMX1 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EMX1. |
Chicken Polyclonal EMX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | EMX1 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human EMX1. |
Rabbit Polyclonal Anti-EMX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EMX1 antibody: synthetic peptide directed towards the middle region of human EMX1. Synthetic peptide located within the following region: DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSL |
Rabbit Polyclonal Anti-EMX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EMX1 antibody: synthetic peptide directed towards the middle region of human EMX1. Synthetic peptide located within the following region: DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSL |
Emx1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
EMX1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human EMX1 |
EMX1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 70-190 of human EMX1 (NP_004088.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EMX1