Antibodies

Jump to Filters
View as table Download
ENC1 Chicken Polyclonal Antibody
TA306962

USD 430.00

5 Days

Chicken Polyclonal ENC-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ENC-1 antibody was raised against a 13 amino acid peptide near the center of human ENC-1.
ENC1 Rabbit Polyclonal Antibody
TA335766

USD 375.00

5 Days

Rabbit Polyclonal Anti-ENC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENC1 Antibody: synthetic peptide directed towards the N terminal of human ENC1. Synthetic peptide located within the following region: MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLL
Enc1 Goat Polyclonal Antibody
TA311274

USD 375.00

5 Days

Goat Anti-ENC1 Antibody

Applications WB
Reactivities Rat
Immunogen Peptide with sequence TSVSHDKLPKVQC, from the internal region of the protein sequence according to NP_003624.1; NP_001243505.1 .
ENC1 Rabbit Polyclonal Antibody
TA375893

USD 220.00

3 Weeks

ENC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human ENC1 (NP_003624.1).
Modifications Unmodified