Antibodies

View as table Download

Rabbit Polyclonal Anti-EPHB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHB3 antibody is: synthetic peptide directed towards the C-terminal region of Human EPHB3. Synthetic peptide located within the following region: QLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQYI

Rabbit Polyclonal Anti-EPHB3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EPHB3

EPHB3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EPHB3

Eph receptor B3 (EPHB3) Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-560 of human Eph receptor B3 (Eph receptor B3 (EPHB3)) (NP_004434.2).
Modifications Unmodified