Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ERF antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ERF. |
Antibodies
View as table Download
Rabbit polyclonal Pim-1 (Tyr309) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Pim-1 around the phosphorylation site of tyrosine 309 (H-R-YP-H-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-ERF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERF antibody: synthetic peptide directed towards the C terminal of human ERF. Synthetic peptide located within the following region: GGLAEGAGALAPPPPPPQIKVEPISEGESEEVEVTDISDEDEEDGEVFKT |
Rabbit Polyclonal Anti-ERF Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-ERF antibody: synthetic peptide directed towards the middle region of human ERF. Synthetic peptide located within the following region: SSSPFKFKLQRPPLGRRQRAAGEKAVAAADKSGGSAGGLAEGAGALAPPP |
Rabbit Polyclonal Anti-ERF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERF antibody: synthetic peptide directed towards the N terminal of human ERF. Synthetic peptide located within the following region: MKTPADTGFAFPDWAYKPESSPGSRQIQLWHFILELLRKEEYQGVIAWQG |
ERF Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ERF |
Active filters
Target Symbol
- ERF