Antibodies

Jump to Filters
View as table Download
FAM120C Rabbit Polyclonal Antibody
TA343049

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM120C Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM120? antibody: synthetic peptide directed towards the N terminal of human FAM120?. Synthetic peptide located within the following region: IKAVSEYVSSIKDPSNLDVVGKDVFKQSQSRTEDKIERFKKAVEYYSVTT
FAM120C Rabbit Polyclonal Antibody
TA357733

USD 360.00

5 Days

FAM120C Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FAM120C